ING3 monoclonal antibody (M02), clone 2C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ING3 monoclonal antibody (M02), clone 2C4 Western Blot analysis of ING3 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ING3 is approximately 1ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ING3 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ING3.
Immunogen
ING3 (NP_938008, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ING3 monoclonal antibody (M02), clone 2C4 Western Blot analysis of ING3 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ING3 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ING3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ING3
Entrez GeneID
54556GeneBank Accession#
NM_198267Protein Accession#
NP_938008Gene Name
ING3
Gene Alias
Eaf4, FLJ20089, ING2, p47ING3
Gene Description
inhibitor of growth family, member 3
Omim ID
607493Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers. Two alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com