RNF186 monoclonal antibody (M01), clone 4F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF186 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.1 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RNF186.
Immunogen
RNF186 (NP_061935, 75 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DNTWSITCPLCRKVTAVPGGLICSLRDHEAVVGQLAQPCTEVSLCPQGLVDPADLAAGHPSLVGEDGQDEVSANHV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (70)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.1 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNF186 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — RNF186
-
Interactome
-
Publication Reference
-
Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
McGovern DP, Gardet A, Torkvist L, Goyette P, Essers J, Taylor KD, Neale BM, Ong RT, Lagace C, Li C, Green T, Stevens CR, Beauchamp C, Fleshner PR, Carlson M, D'Amato M, Halfvarson J, Hibberd ML, Lordal M, Padyukov L, Andriulli A, Colombo E, Latiano A, Palmieri O, Bernard EJ, Deslandres C, Hommes DW, de Jong DJ, Stokkers PC, Weersma RK; NIDDK IBD Genetics Consortium, Sharma Y, Silverberg MS, Cho JH, Wu J, Roeder K, Brant SR, Schumm LP, Duerr RH, Dubinsky MC, Glazer NL, Haritunians T, Ippoliti A,
Nature Genetics 2010 Apr; 42(4):332.
Application：IHC-Fr, Human, Human colon tissues.
-
Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com