NDUFB11 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NDUFB11 full-length ORF ( AAH10665, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.57
Interspecies Antigen Sequence
Rat (73)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NDUFB11
Entrez GeneID
54539GeneBank Accession#
BC010665Protein Accession#
AAH10665Gene Name
NDUFB11
Gene Alias
ESSS, FLJ20494, MGC111182, NP17.3, Np15, P17.3
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa
Omim ID
300403Gene Ontology
HyperlinkGene Summary
NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM
Other Designations
OTTHUMP00000023194|neuronal protein 17.3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com