NDUFB11 monoclonal antibody (M08), clone 4B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NDUFB11.
Immunogen
NDUFB11 (AAH10665, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (73)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.57 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDUFB11 monoclonal antibody (M08), clone 4B2. Western Blot analysis of NDUFB11 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
NDUFB11 monoclonal antibody (M08), clone 4B2 Western Blot analysis of NDUFB11 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NDUFB11 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — NDUFB11
Entrez GeneID
54539GeneBank Accession#
BC010665Protein Accession#
AAH10665Gene Name
NDUFB11
Gene Alias
ESSS, FLJ20494, MGC111182, NP17.3, Np15, P17.3
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa
Omim ID
300403Gene Ontology
HyperlinkGene Summary
NDUFB11 is a component of mitochondrial complex I. Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane (Carroll et al., 2002 [PubMed 12381726]).[supplied by OMIM
Other Designations
OTTHUMP00000023194|neuronal protein 17.3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com