MRPL50 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MRPL50 expression in transfected 293T cell line (H00054534-T01) by MRPL50 MaxPab polyclonal antibody.
Lane 1: MRPL50 transfected lysate(17.38 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MRPL50 protein.
Immunogen
MRPL50 (NP_061924, 1 a.a. ~ 158 a.a) full-length human protein.
Sequence
MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (76)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MRPL50 expression in transfected 293T cell line (H00054534-T01) by MRPL50 MaxPab polyclonal antibody.
Lane 1: MRPL50 transfected lysate(17.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MRPL50
Entrez GeneID
54534GeneBank Accession#
NM_019051Protein Accession#
NP_061924Gene Name
MRPL50
Gene Alias
FLJ20493, FLJ21990, MRP-L50
Gene Description
mitochondrial ribosomal protein L50
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q. [provided by RefSeq
Other Designations
OTTHUMP00000021811|mitochondrial 39S ribosomal protein L50
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com