Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APBB1IP (Human) Recombinant Protein (P02)

  • Catalog # : H00054518-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APBB1IP full-length ORF ( ENSP00000349237, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00054518-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • APBB1IP
  • Gene Alias:
  • INAG1,PREL1,RARP1,RIAM
  • Gene Description:
  • amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
  • Other Designations:
  • OTTHUMP00000019344,Rap1-interacting adaptor molecule,proline rich EVH1 ligand 1,proline-rich protein 73,retinoic acid-responsive proline-rich protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook