DDX4 monoclonal antibody (M06), clone 3D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DDX4 expression in transfected 293T cell line by DDX4 monoclonal antibody (M06), clone 3D5.
Lane 1: DDX4 transfected lysate (Predicted MW: 75.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DDX4.
Immunogen
DDX4 (NP_061912.1, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DDX4 expression in transfected 293T cell line by DDX4 monoclonal antibody (M06), clone 3D5.
Lane 1: DDX4 transfected lysate (Predicted MW: 75.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — DDX4
Entrez GeneID
54514GeneBank Accession#
NM_019039Protein Accession#
NP_061912.1Gene Name
DDX4
Gene Alias
MGC111074, VASA
Gene Description
DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
Omim ID
605281Gene Ontology
HyperlinkGene Summary
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a homolog of VASA proteins in Drosophila and several other species. The gene is specifically expressed in the germ cell lineage in both sexes and functions in germ cell development. [provided by RefSeq
Other Designations
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4|OTTHUMP00000122546
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com