DNAJC10 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant DNAJC10.
Immunogen
DNAJC10 (NP_061854, 688 a.a. ~ 793 a.a) partial recombinant protein with GST tag.
Sequence
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.77 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — DNAJC10
Entrez GeneID
54431GeneBank Accession#
NM_018981Protein Accession#
NP_061854Gene Name
DNAJC10
Gene Alias
DKFZp434J1813, ERdj5, JPDI, MGC104194
Gene Description
DnaJ (Hsp40) homolog, subfamily C, member 10
Omim ID
607987Gene Ontology
HyperlinkGene Summary
subfamily C
Other Designations
ER-resident protein ERdj5|J-domain-containing protein disulfide isomerase-like protein|macrothioredoxin
-
Interactome
-
Publication Reference
-
Loss of ERdj5 exacerbates oxidative stress in mice with alcoholic liver disease via suppressing Nrf2.
Dong-Gyun Hong, Ga Yeon Song, Cheol Bin Eom, Jae-Hee Ahn, Sun Myoung Kim, Aeri Shim, Yong-Hyun Han, Yoon-Seok Roh, Chang Yeob Han, Eun Ju Bae, Hyun-Jeong Ko, Yoon Mee Yang.
Free Radical Biology & Medicine 2022 May; 184:42.
Application:WB-Ce, WB-Ti, Mouse, AML-12 cells, Mouse liver, primary hepatocyte.
-
Glycosylation-independent ERAD pathway serves as a backup system under ER stress.
Ushioda R, Hoseki J, Nagata K.
Molecular Biology of the Cell 2013 Oct; 24(20):3155.
Application:WB-Tr, Human, HEK 293T cells.
-
ERdj5 is required as a disulfide reductase for degradation of misfolded proteins in the ER.
Ushioda R, Hoseki J, Araki K, Jansen G, Thomas DY, Nagata K.
Science 2008 Jul; 321(5888):569.
Application:WB, Human, HeLa, HEK 293 cells.
-
Targeting homeostatic mechanisms of endoplasmic reticulum stress to increase susceptibility of cancer cells to fenretinide-induced apoptosis: the role of stress proteins ERdj5 and ERp57.
Corazzari M, Lovat PE, Armstrong JL, Fimia GM, Hill DS, Birch-Machin M, Redfern CP, Piacentini M.
British Journal of Cancer 2007 Mar; 96(7):1062.
Application:WB, Human, A375, SH-SY5Y cells.
-
Loss of ERdj5 exacerbates oxidative stress in mice with alcoholic liver disease via suppressing Nrf2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com