ERRFI1 monoclonal antibody (M01), clone 2B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ERRFI1.
Immunogen
ERRFI1 (NP_061821, 111 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VVCGFKKLTVNGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTDFLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (81); Rat (82)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ERRFI1 monoclonal antibody (M01), clone 2B9 Western Blot analysis of ERRFI1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ERRFI1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — ERRFI1
Entrez GeneID
54206GeneBank Accession#
NM_018948Protein Accession#
NP_061821Gene Name
ERRFI1
Gene Alias
GENE-33, MIG-6, MIG6, RALT
Gene Description
ERBB receptor feedback inhibitor 1
Omim ID
608069Gene Ontology
HyperlinkGene Summary
ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling (Makkinje et al., 2000 [PubMed 10749885]; Fiorentino et al., 2000 [PubMed 11003669]).[supplied by OMIM
Other Designations
OTTHUMP00000001359|mitogen-inducible gene 6|mitogen-inducible gene 6 protein|receptor-associated late transducer
-
Interactome
-
Publication Reference
-
MIG6 mediates adaptive and acquired resistance to ALK/ROS1 fusion kinase inhibition through EGFR bypass signaling.
Nan Chen, Logan C Tyler, Anh T Le, Eric A Welsh, Bin Fang, Andrew Elliott, Kurtis D Davies, Thomas Danhorn, Gregory J Riely, Marc Ladanyi, Eric B Haura, Robert C Doebele.
Molecular Cancer Therapeutics 2023 Sep; [Epub].
Application:WB, Human, CUTO28, CUTO37, CUTO63 cells.
-
Inhibition of KHSRP sensitizes colorectal cancer to 5-fluoruracil through miR-501-5p-mediated ERRFI1 mRNA degradation.
Pan R, Cai W, Sun J, Yu C, Li P, Zheng M.
Journal of Cellular Physiology 2019 Jul; [Epub].
Application:IHC-P, Human, Human colorectal cancer tumor samples.
-
MIG6 mediates adaptive and acquired resistance to ALK/ROS1 fusion kinase inhibition through EGFR bypass signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com