Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCUN1D1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00054165-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human DCUN1D1 protein.
  • Immunogen:
  • DCUN1D1 (NP_065691.2, 1 a.a. ~ 259 a.a) full-length human protein.
  • Sequence:
  • MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • DCUN1D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of DCUN1D1 expression in mouse liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DCUN1D1 expression in transfected 293T cell line (H00054165-T02) by DCUN1D1 MaxPab polyclonal antibody.

    Lane 1: DCUN1D1 transfected lysate(30.1 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of DCUN1D1 transfected lysate using anti-DCUN1D1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DCUN1D1 MaxPab mouse polyclonal antibody (B01) (H00054165-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DCUN1D1
  • Gene Alias:
  • DCUN1L1,RP42,SCCRO,SCRO,Tes3
  • Gene Description:
  • DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
  • Other Designations:
  • RP42 homolog,squamous cell carcinoma-related oncogene
  • RSS
  • YouTube
  • Linkedin
  • Facebook