Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCUN1D1 polyclonal antibody (A01)

  • Catalog # : H00054165-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DCUN1D1.
  • Immunogen:
  • DCUN1D1 (NP_065691, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00054165-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • DCUN1D1 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of DCUN1D1 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DCUN1D1
  • Gene Alias:
  • DCUN1L1,RP42,SCCRO,SCRO,Tes3
  • Gene Description:
  • DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
  • Other Designations:
  • RP42 homolog,squamous cell carcinoma-related oncogene
  • RSS
  • YouTube
  • Linkedin
  • Facebook