Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHRAC1 monoclonal antibody (M11), clone 4E7

  • Catalog # : H00054108-M11
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CHRAC1.
  • Immunogen:
  • CHRAC1 (NP_059140, 1 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00054108-M11
    Western Blot detection against Immunogen (36.3 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CHRAC1 expression in transfected 293T cell line by CHRAC1 monoclonal antibody (M11), clone 4E7.

    Lane 1: CHRAC1 transfected lysate(14.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CHRAC1
  • Gene Alias:
  • CHARC1,CHARC15,CHRAC15,YCL1
  • Gene Description:
  • chromatin accessibility complex 1
  • Gene Summary:
  • CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM
  • Other Designations:
  • histone-fold protein CHRAC15
  • RSS
  • YouTube
  • Linkedin
  • Facebook