POLE3 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
POLE3 MaxPab polyclonal antibody. Western Blot analysis of POLE3 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T02) by POLE3 MaxPab polyclonal antibody.
Lane 1: POLE3 transfected lysate(16.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to POLE3 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human POLE3 protein.
Immunogen
POLE3 (AAH03166.1, 1 a.a. ~ 147 a.a) full-length human protein.
Sequence
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
POLE3 MaxPab polyclonal antibody. Western Blot analysis of POLE3 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T02) by POLE3 MaxPab polyclonal antibody.
Lane 1: POLE3 transfected lysate(16.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to POLE3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — POLE3
Entrez GeneID
54107GeneBank Accession#
BC003166Protein Accession#
AAH03166.1Gene Name
POLE3
Gene Alias
CHARAC17, CHRAC17, YBL1, p17
Gene Description
polymerase (DNA directed), epsilon 3 (p17 subunit)
Omim ID
607267Gene Ontology
HyperlinkGene Summary
POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM
Other Designations
DNA polymerase epsilon p17 subunit|DNA polymerase epsilon subunit 3|OTTHUMP00000021954|OTTHUMP00000021955|arsenic transactivated protein|chromatin accessibility complex 17|histone fold protein CHRAC17
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com