Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

POLE3 MaxPab mouse polyclonal antibody (B01P) MaxPab

  • Catalog # : H00054107-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human POLE3 protein.
  • Immunogen:
  • POLE3 (AAH03166, 1 a.a. ~ 147 a.a) full-length human protein.
  • Sequence:
  • MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Interspecies Antigen Sequence:
  • Mouse (93); Rat (95)
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of POLE3 expression in transfected 293T cell line (H00054107-T01) by POLE3 MaxPab polyclonal antibody.

    Lane 1: POLE3 transfected lysate(16.28 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of purified MaxPab antibody to POLE3 on HeLa cell. [antibody concentration 10 ug/ml]
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • POLE3
  • Gene Alias:
  • CHARAC17,CHRAC17,YBL1,p17
  • Gene Description:
  • polymerase (DNA directed), epsilon 3 (p17 subunit)
  • Gene Summary:
  • POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM
  • Other Designations:
  • DNA polymerase epsilon p17 subunit,DNA polymerase epsilon subunit 3,OTTHUMP00000021954,OTTHUMP00000021955,arsenic transactivated protein,chromatin accessibility complex 17,histone fold protein CHRAC17
  • RSS
  • YouTube
  • Linkedin
  • Facebook