TLR9 monoclonal antibody (M05), clone 2H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant TLR9.
Immunogen
TLR9 (AAH32713, 99 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVP
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TLR9 monoclonal antibody (M05), clone 2H5 Western Blot analysis of TLR9 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
TLR9 monoclonal antibody (M05), clone 2H5 Western Blot analysis of TLR9 expression in NIH/3T3 ( Cat # L018V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TLR9 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — TLR9
Entrez GeneID
54106GeneBank Accession#
BC032713Protein Accession#
AAH32713Gene Name
TLR9
Gene Alias
CD289
Gene Description
toll-like receptor 9
Omim ID
605474Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylated CpG dinucleotides in bacterial DNA to mount an innate immune response. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Pathways
-
Diseases
- Adenocarcinoma
- Anemia
- Arthritis
- Arthropathy
- Aspergillosis
- Asthma
- Atherosclerosis
- Behcet Syndrome
- Birth Weight
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com