FAM3B monoclonal antibody (M07), clone 1E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FAM3B monoclonal antibody (M07), clone 1E7. Western Blot analysis of FAM3B expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody (M07), clone 1E7.
Lane 1: FAM3B transfected lysate(26 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of FAM3B transfected lysate using anti-FAM3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FAM3B MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM3B is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.59 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FAM3B.
Immunogen
FAM3B (AAH57829.1, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (75)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.59 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FAM3B monoclonal antibody (M07), clone 1E7. Western Blot analysis of FAM3B expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody (M07), clone 1E7.
Lane 1: FAM3B transfected lysate(26 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of FAM3B transfected lysate using anti-FAM3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FAM3B MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM3B is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — FAM3B
Entrez GeneID
54097GeneBank Accession#
BC057829Protein Accession#
AAH57829.1Gene Name
FAM3B
Gene Alias
2-21, C21orf11, C21orf76, ORF9, PANDER, PRED44
Gene Description
family with sequence similarity 3, member B
Omim ID
608617Gene Ontology
HyperlinkGene Summary
O
Other Designations
D21M16SJHU19e|OTTHUMP00000109240|cytokine-like protein 2-21|pancreatic derived factor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com