Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FAM3B purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00054097-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FAM3B protein.
  • Immunogen:
  • FAM3B (NP_478066.3, 1 a.a. ~ 235 a.a) full-length human protein.
  • Sequence:
  • MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FAM3B MaxPab rabbit polyclonal antibody. Western Blot analysis of FAM3B expression in mouse intestine.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FAM3B expression in transfected 293T cell line (H00054097-T04) by FAM3B MaxPab polyclonal antibody.

    Lane 1: FAM3B transfected lysate(26.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • FAM3B
  • Gene Alias:
  • 2-21,C21orf11,C21orf76,ORF9,PANDER,PRED44
  • Gene Description:
  • family with sequence similarity 3, member B
  • Other Designations:
  • D21M16SJHU19e,OTTHUMP00000109240,cytokine-like protein 2-21,pancreatic derived factor
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook