Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRWD1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00054014-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human BRWD1 protein.
  • Immunogen:
  • BRWD1 (NP_001007247.1, 1 a.a. ~ 120 a.a) full-length human protein.
  • Sequence:
  • MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BRWD1 expression in transfected 293T cell line (H00054014-T01) by BRWD1 MaxPab polyclonal antibody.

    Lane1:BRWD1 transfected lysate(13.2 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • BRWD1
  • Gene Alias:
  • C21orf107,FLJ43918,N143,WDR9
  • Gene Description:
  • bromodomain and WD repeat domain containing 1
  • Gene Summary:
  • This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3' ends. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000068928,WD repeat domain 9,WD repeat protein WDR9-form2,cAMP response element binding and beta-tranducin family-like,transcriptional unit N143
  • RSS
  • YouTube
  • Linkedin
  • Facebook