BRWD1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human BRWD1 protein.
Immunogen
BRWD1 (NP_001007247.1, 1 a.a. ~ 120 a.a) full-length human protein.
Sequence
MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BRWD1 expression in transfected 293T cell line (H00054014-T01) by BRWD1 MaxPab polyclonal antibody.
Lane1:BRWD1 transfected lysate(13.2 KDa).
Lane2:Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to BRWD1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — BRWD1
Entrez GeneID
54014GeneBank Accession#
NM_001007246.1Protein Accession#
NP_001007247.1Gene Name
BRWD1
Gene Alias
C21orf107, FLJ43918, N143, WDR9
Gene Description
bromodomain and WD repeat domain containing 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats, and the function of this protein is not known. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates 3 transcript variants diverging at the 3' ends. [provided by RefSeq
Other Designations
OTTHUMP00000068928|WD repeat domain 9|WD repeat protein WDR9-form2|cAMP response element binding and beta-tranducin family-like|transcriptional unit N143
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com