Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

A4GALT monoclonal antibody (M08), clone 3E12

  • Catalog # : H00053947-M08
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant A4GALT.
  • Immunogen:
  • A4GALT (NP_059132, 254 a.a. ~ 353 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • A4GALT
  • Gene Alias:
  • A14GALT,A4GALT1,P1,PK
  • Gene Description:
  • alpha 1,4-galactosyltransferase
  • Gene Summary:
  • The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor. [provided by RefSeq
  • Other Designations:
  • CD77 synthase,GB3 synthase,P blood group (P one antigen),P(k) antigen synthase,P1/Pk synthase,UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase,alpha-1,4-N-acetylglucosaminyltransferase,alpha4Gal-T1,globotriaosylceramide synthase,lac
  • RSS
  • YouTube
  • Linkedin
  • Facebook