CSNK1G1 monoclonal antibody (M01), clone 3D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CSNK1G1 monoclonal antibody (M01), clone 3D1 Western Blot analysis of CSNK1G1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of CSNK1G1 expression in transfected 293T cell line by CSNK1G1 monoclonal antibody (M01), clone 3D1.
Lane 1: CSNK1G1 transfected lysate(45.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSNK1G1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSNK1G1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
Immunogen
CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (95)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CSNK1G1 monoclonal antibody (M01), clone 3D1 Western Blot analysis of CSNK1G1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of CSNK1G1 expression in transfected 293T cell line by CSNK1G1 monoclonal antibody (M01), clone 3D1.
Lane 1: CSNK1G1 transfected lysate(45.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSNK1G1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSNK1G1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CSNK1G1
Entrez GeneID
53944GeneBank Accession#
BC017236Protein Accession#
AAH17236Gene Name
CSNK1G1
Gene Alias
-
Gene Description
casein kinase 1, gamma 1
Omim ID
606274Gene Ontology
HyperlinkGene Summary
Casein kinase I is the most abundant serine/threonine kinase in eukaryotic cell extracts. Multiple isoforms of the enzyme exist. The gamma-1 isoform is involved in growth and morphogenesis of eukaryotic cells.[supplied by OMIM
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com