Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPIL3 MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00053938-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PPIL3 protein.
  • Immunogen:
  • PPIL3 (NP_115861.1, 1 a.a. ~ 165 a.a) full-length human protein.
  • Sequence:
  • MSVTLHTDVGDIKIEVFCERTPKTCEMESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PPIL3 expression in transfected 293T cell line (H00053938-T02) by PPIL3 MaxPab polyclonal antibody.

    Lane1:PPIL3 transfected lysate(18.15 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • PPIL3
  • Gene Alias:
  • CYPJ
  • Gene Description:
  • peptidylprolyl isomerase (cyclophilin)-like 3
  • Gene Summary:
  • This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • PPIase-like protein 3,cyclophilin J,cyclophilin-like protein 3,peptidylprolyl cis-trans isomerase-like protein 3,peptidylprolyl isomerase-like 3
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook