PANK1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PANK1 expression in transfected 293T cell line by PANK1 polyclonal antibody (A01).
Lane1:PANK1 transfected lysate (Predicted MW: 41.7 KDa).
Lane2:Non-transfected lysate.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PANK1.
Immunogen
PANK1 (NP_683878, 310 a.a. ~ 409 a.a) partial recombinant protein with GST tag.
Sequence
IRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PANK1 expression in transfected 293T cell line by PANK1 polyclonal antibody (A01).
Lane1:PANK1 transfected lysate (Predicted MW: 41.7 KDa).
Lane2:Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — PANK1
Entrez GeneID
53354GeneBank Accession#
NM_148977Protein Accession#
NP_683878Gene Name
PANK1
Gene Alias
MGC24596, PANK, PANK1a, PANK1b
Gene Description
pantothenate kinase 1
Omim ID
606160Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by CoA. Alternative splicing has been observed at this locus and three variants, each encoding a distinct isoform, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000020071|OTTHUMP00000020072|pantothenic acid kinase
-
Pathway
-
Disease
-
Publication Reference
-
p53 activates the PANK1/miRNA-107 gene leading to downregulation of CDK6 and p130 cell cycle proteins.
Bohlig L, Friedrich M, Engeland K.
Nucleic Acids Research 2011 Jan; 39(2):440.
Application：WB-Ce, WB-Tr, Human, HCT-116 cells.
-
p53 activates the PANK1/miRNA-107 gene leading to downregulation of CDK6 and p130 cell cycle proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com