IL17D MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
IL17D MaxPab rabbit polyclonal antibody. Western Blot analysis of IL17D expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of IL17D expression in transfected 293T cell line (H00053342-T01) by IL17D MaxPab polyclonal antibody.
Lane 1: IL17D transfected lysate(21.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IL17D transfected lysate using anti-IL17D MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL17D MaxPab mouse polyclonal antibody (B01) (H00053342-B01).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL17D protein.
Immunogen
IL17D (NP_612141.1, 1 a.a. ~ 202 a.a) full-length human protein.
Sequence
MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IL17D MaxPab rabbit polyclonal antibody. Western Blot analysis of IL17D expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of IL17D expression in transfected 293T cell line (H00053342-T01) by IL17D MaxPab polyclonal antibody.
Lane 1: IL17D transfected lysate(21.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IL17D transfected lysate using anti-IL17D MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL17D MaxPab mouse polyclonal antibody (B01) (H00053342-B01). -
Gene Info — IL17D
Entrez GeneID
53342GeneBank Accession#
NM_138284Protein Accession#
NP_612141.1Gene Name
IL17D
Gene Alias
FLJ30846, IL-17D, IL-22, IL-27, IL27
Gene Description
interleukin 17D
Omim ID
607587Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent. [provided by RefSeq
Other Designations
OTTHUMP00000018104|interleukin 27
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com