SPA17 monoclonal antibody (M03), clone 3B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SPA17 expression in transfected 293T cell line by SPA17 monoclonal antibody (M03), clone 3B6.
Lane 1: SPA17 transfected lysate (Predicted MW: 17.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPA17 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SPA17.
Immunogen
SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (72)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPA17 expression in transfected 293T cell line by SPA17 monoclonal antibody (M03), clone 3B6.
Lane 1: SPA17 transfected lysate (Predicted MW: 17.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPA17 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SPA17
Entrez GeneID
53340GeneBank Accession#
NM_017425Protein Accession#
NP_059121Gene Name
SPA17
Gene Alias
SP17, SP17-1
Gene Description
sperm autoantigenic protein 17
Omim ID
608621Gene Ontology
HyperlinkGene Summary
This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22
Other Designations
sperm protein 17
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com