SPA17 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SPA17 expression in transfected 293T cell line (H00053340-T01) by SPA17 MaxPab polyclonal antibody.
Lane 1: SPA17 transfected lysate(16.61 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to SPA17 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SPA17 on Hs 181.Tes cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SPA17 protein.
Immunogen
SPA17 (NP_059121.1, 1 a.a. ~ 151 a.a) full-length human protein.
Sequence
MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (72)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SPA17 expression in transfected 293T cell line (H00053340-T01) by SPA17 MaxPab polyclonal antibody.
Lane 1: SPA17 transfected lysate(16.61 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to SPA17 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SPA17 on Hs 181.Tes cell. [antibody concentration 10 ug/ml] -
Gene Info — SPA17
Entrez GeneID
53340GeneBank Accession#
NM_017425.2Protein Accession#
NP_059121.1Gene Name
SPA17
Gene Alias
SP17, SP17-1
Gene Description
sperm autoantigenic protein 17
Omim ID
608621Gene Ontology
HyperlinkGene Summary
This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22
Other Designations
sperm protein 17
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com