BCL11A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BCL11A partial ORF ( NP_060484, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.42
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BCL11A
Entrez GeneID
53335GeneBank Accession#
NM_018014Protein Accession#
NP_060484Gene Name
BCL11A
Gene Alias
BCL11A-L, BCL11A-S, BCL11A-XL, CTIP1, EVI9, FLJ10173, FLJ34997, HBFQTL5, KIAA1809, ZNF856
Gene Description
B-cell CLL/lymphoma 11A (zinc finger protein)
Gene Ontology
HyperlinkGene Summary
This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Other Designations
B-cell CLL/lymphoma 11A|C2H2-type zinc finger protein|ecotropic viral integration site 9 homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com