BCL11A monoclonal antibody (M03), clone 3D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody (M03), clone 3D9.
Lane 1: BCL11A transfected lysate(26.865 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BCL11A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCL11A is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to BCL11A on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BCL11A.
Immunogen
BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BCL11A expression in transfected 293T cell line by BCL11A monoclonal antibody (M03), clone 3D9.
Lane 1: BCL11A transfected lysate(26.865 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BCL11A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BCL11A is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to BCL11A on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — BCL11A
Entrez GeneID
53335GeneBank Accession#
NM_018014Protein Accession#
NP_060484Gene Name
BCL11A
Gene Alias
BCL11A-L, BCL11A-S, BCL11A-XL, CTIP1, EVI9, FLJ10173, FLJ34997, HBFQTL5, KIAA1809, ZNF856
Gene Description
B-cell CLL/lymphoma 11A (zinc finger protein)
Gene Ontology
HyperlinkGene Summary
This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Other Designations
B-cell CLL/lymphoma 11A|C2H2-type zinc finger protein|ecotropic viral integration site 9 homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com