Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BCL11A polyclonal antibody (A01)

  • Catalog # : H00053335-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BCL11A.
  • Immunogen:
  • BCL11A (NP_060484, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00053335-A01
    Western Blot detection against Immunogen (35.79 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • BCL11A
  • Gene Alias:
  • BCL11A-L,BCL11A-S,BCL11A-XL,CTIP1,EVI9,FLJ10173,FLJ34997,HBFQTL5,KIAA1809,ZNF856
  • Gene Description:
  • B-cell CLL/lymphoma 11A (zinc finger protein)
  • Gene Summary:
  • This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • B-cell CLL/lymphoma 11A,C2H2-type zinc finger protein,ecotropic viral integration site 9 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook