ZAK monoclonal antibody (M02), clone 3D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ZAK.
Immunogen
ZAK (AAH01401.1, 1 a.a. ~ 455 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEESNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGKKVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (75.79 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZAK is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ZAK on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ZAK
Entrez GeneID
51776GeneBank Accession#
BC001401Protein Accession#
AAH01401.1Gene Name
ZAK
Gene Alias
AZK, MLK7, MLT, MLTK, MRK, mlklak
Gene Description
sterile alpha motif and leucine zipper containing kinase AZK
Omim ID
609479Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
MLK-like mitogen-activated protein triple kinase|MLK-related kinase|cervical cancer suppressor gene 4 protein|leucine zipper- and sterile alpha motif-containing kinase|mitogen-activated protein kinase kinase kinase MLT|mixed lineage kinase 7|mixed lineage
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
ZAKβ Alleviates Oxidized Low-density Lipoprotein (ox-LDL)-Induced Apoptosis and B-type Natriuretic Peptide (BNP) Upregulation in Cardiomyoblast.
Yueh-Min Lin, Jiro Hasegawa Situmorang, Jia-Zun Guan, Dennis Jine-Yuan Hsieh, Jaw-Ji Yang, Michael Yu-Chih Chen, Ching-Hui Loh, Chia-Hua Kuo, Shang-Yeh Lu, Ying-Ming Liou, Chih-Yang Huang.
Cell Biochemistry and Biophysics 2022 Sep; 80(3):547.
Application:WB-Ce, Human, H9c2 cells.
-
Fisetin activates Hippo pathway and JNK/ERK/AP-1 signaling to inhibit proliferation and induce apoptosis of human osteosarcoma cells via ZAK overexpression.
Fu CY, Chen MC, Tseng YS, Chen MC, Zhou Z, Yang JJ, Lin YM, Viswanadha VP, Wang G, Huang CY.
Environmental Toxicology 2019 Aug; 34(8):902.
Application:WB-Ce, WB-Tr, Human, Human OS cells.
-
Overexpression of ZAKβ in human osteosarcoma cells enhances ZAKα expression, resulting in a synergistic apoptotic effect.
Fu CY, Tseng YS, Chen MC, Hsu HH, Yang JJ, Tu CC, Lin YM, Viswanadha VP, Ding K, Kuo WW, Huang CY.
Cell Biochemistry and Function 2018 Jun; 36(4):176.
Application:WB-Tr, Human, HOS cells.
-
ZAKβ Alleviates Oxidized Low-density Lipoprotein (ox-LDL)-Induced Apoptosis and B-type Natriuretic Peptide (BNP) Upregulation in Cardiomyoblast.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com