HBXAP monoclonal antibody (M05), clone 3E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HBXAP.
Immunogen
HBXAP (NP_057662.3, 1343 a.a. ~ 1441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HBXAP is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RSF1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RSF1
Entrez GeneID
51773GeneBank Accession#
NM_016578Protein Accession#
NP_057662.3Gene Name
RSF1
Gene Alias
HBXAP, RSF-1, XAP8, p325
Gene Description
remodeling and spacing factor 1
Omim ID
608522Gene Ontology
HyperlinkGene Summary
HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H (MIM 603375).[supplied by OMIM
Other Designations
HBV pX associated protein-8|hepatitis B virus x associated protein|hepatitis B virus x-associated protein
-
Interactome
-
Publication Reference
-
Post-Translational Regulation of the RSF1 Chromatin Remodeler under DNA Damage.
Min S, Choi YW, Yun H, Jo S, Ji JH, Cho H.
Molecules and Cells 2018 Feb; 41(2):127.
Application:WB-Ce, WB-Tr, Human, EJ cells, MCF-7, U-2 OS cells.
-
HBxAPα/Rsf-1-mediated HBx-hBubR1 interactions regulate the mitotic spindle checkpoint and chromosome instability.
Chae S, Ji JH, Kwon S, Lee HS, Lim J, Kang D, Lee C, Cho H.
Carcinogenesis 2013 Jul; 34(7):1680.
Application:IP-WB, WB-Tr, Human, HeLa cells.
-
Post-Translational Regulation of the RSF1 Chromatin Remodeler under DNA Damage.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com