Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RP6-213H19.1 (Human) Recombinant Protein (P01)

  • Catalog # : H00051765-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RP6-213H19.1 full-length ORF ( AAH17213, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.81
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051765-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RP6-213H19.1
  • Gene Alias:
  • MASK,MST4
  • Gene Description:
  • serine/threonine protein kinase MST4
  • Gene Summary:
  • The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
  • Other Designations:
  • Mst3 and SOK1-related kinase,STE20-like kinase MST4,mammalian Ste20-like protein kinase 4,mammalian sterile 20-like 4,serine/threonine protein kinase MASK
  • RSS
  • YouTube
  • Linkedin
  • Facebook