RP6-213H19.1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human RP6-213H19.1 protein.
Immunogen
RP6-213H19.1 (NP_057626.2, 1 a.a. ~ 416 a.a) full-length human protein.
Sequence
MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RP6-213H19.1 MaxPab polyclonal antibody. Western Blot analysis of RP6-213H19.1 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of RP6-213H19.1 expression in transfected 293T cell line (H00051765-T01) by RP6-213H19.1 MaxPab polyclonal antibody.
Lane 1: RP6-213H19.1 transfected lysate(45.76 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RP6-213H19.1
Entrez GeneID
51765GeneBank Accession#
NM_016542.3Protein Accession#
NP_057626.2Gene Name
RP6-213H19.1
Gene Alias
MASK, MST4
Gene Description
serine/threonine protein kinase MST4
Omim ID
300547Gene Ontology
HyperlinkGene Summary
The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
Mst3 and SOK1-related kinase|STE20-like kinase MST4|mammalian Ste20-like protein kinase 4|mammalian sterile 20-like 4|serine/threonine protein kinase MASK
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com