CROP polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CROP.
Immunogen
CROP (NP_006098, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Sequence
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CROP polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of CROP expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CROP
Entrez GeneID
51747GeneBank Accession#
NM_006107Protein Accession#
NP_006098Gene Name
CROP
Gene Alias
LUC7A, OA48-18
Gene Description
cisplatin resistance-associated overexpressed protein
Omim ID
609434Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
okadaic acid-inducible phosphoprotein
-
Interactome
-
Disease
-
Publication Reference
-
Proteome-Wide Identification of Novel Binding Partners to the Oncogenic Fusion Gene Protein, NPM-ALK, using Tandem Affinity Purification and Mass Spectrometry.
Wu F, Wang P, Young LC, Lai R, Li L.
The American Journal of Pathology 2009 Feb; 174(2):361.
Application:WB-Ce, Human, SUP-M2, Karpas299.
-
Novel splicing factor RBM25 modulates Bcl-x pre-mRNA 5' splice site selection.
Zhou A, Ou AC, Cho A, Benz EJ Jr, Huang SC.
Molecular and Cellular Biology 2008 Jul; 28(19):5924.
-
Proteome-Wide Identification of Novel Binding Partners to the Oncogenic Fusion Gene Protein, NPM-ALK, using Tandem Affinity Purification and Mass Spectrometry.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com