WWOX purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human WWOX protein.
Immunogen
WWOX (NP_570607.1, 1 a.a. ~ 189 a.a) full-length human protein.
Sequence
MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWKTKYHPPPEKCRIKIFH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WWOX MaxPab polyclonal antibody. Western Blot analysis of WWOX expression in 293.Western Blot (Transfected lysate)
Western Blot analysis of WWOX expression in transfected 293T cell line (H00051741-T01) by WWOX MaxPab polyclonal antibody.
Lane 1: WWOX transfected lysate(20.79 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WWOX
Entrez GeneID
51741GeneBank Accession#
NM_130791.1Protein Accession#
NP_570607.1Gene Name
WWOX
Gene Alias
D16S432E, FOR, FRA16D, HHCMA56, PRO0128, SDR41C1, WOX1
Gene Description
WW domain containing oxidoreductase
Gene Ontology
HyperlinkGene Summary
WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 2 WW domains and a short-chain dehydrogenase/reductase domain (SRD). The highest normal expression of this gene is detected in hormonally regulated tissues such as testis, ovary, and prostate. This expression pattern and the presence of an SRD domain suggest a role for this gene in steroid metabolism. The encoded protein is more than 90% identical to the mouse protein, which is an essential mediator of tumor necrosis factor-alpha-induced apoptosis, suggesting a similar, important role in apoptosis for the human protein. In addition, there is evidence that this gene behaves as a suppressor of tumor growth. Alternative splicing of this gene generates transcript variants that encode different isoforms. [provided by RefSeq
Other Designations
WW domain-containing oxidoreductase|WW domain-containing protein WWOX|fragile 16D oxido reductase|fragile site FRA16D oxidoreductase|putative oxidoreductase|short chain dehydrogenase/reductase family 41C, member 1
-
Interactome
-
Disease
-
Publication Reference
-
Normal cells repel WWOX-negative or -dysfunctional cancer cells via WWOX cell surface epitope 286-299.
Yu-An Chen, Yong-Da Sie, Tsung-Yun Liu, Hsiang-Ling Kuo, Pei-Yi Chou, Yu-Jie Chen, Kuan-Ting Lee, Pin-Jun Chen, Shur-Tzu Chen, Nan-Shan Chang.
Communications Biology 2021 Jun; 4(1):753.
Application:IP, WB-Ti, Mouse, Mouse liver, Mouse spleen.
-
Normal cells repel WWOX-negative or -dysfunctional cancer cells via WWOX cell surface epitope 286-299.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com