Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RAPGEF6 monoclonal antibody (M02), clone 3A9

  • Catalog # : H00051735-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant RAPGEF6.
  • Immunogen:
  • RAPGEF6 (NP_057424, 1012 a.a. ~ 1110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051735-M02
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RAPGEF6
  • Gene Alias:
  • DKFZp667N084,DKFZp686I15116,KIA001LB,PDZ-GEF2,PDZGEF2,RA-GEF-2,RAGEF2
  • Gene Description:
  • Rap guanine nucleotide exchange factor (GEF) 6
  • Other Designations:
  • PDZ domain containing guanine nucleotide exchange factor (GEF) 2,PDZ domain-containing guanine nucleotide exchange factor I
  • RSS
  • YouTube
  • Linkedin
  • Facebook