SEPX1 monoclonal antibody (M02), clone 8B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody (M02), clone 8B2.
Lane 1: SEPX1 transfected lysate(12.713 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEPX1 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.98 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SEPX1.
Immunogen
SEPX1 (NP_057416, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.98 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody (M02), clone 8B2.
Lane 1: SEPX1 transfected lysate(12.713 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SEPX1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — SEPX1
Entrez GeneID
51734GeneBank Accession#
NM_016332Protein Accession#
NP_057416Gene Name
SEPX1
Gene Alias
HSPC270, MGC3344, MSRB1, SELR, SELX
Gene Description
selenoprotein X, 1
Omim ID
606216Gene Ontology
HyperlinkGene Summary
This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues. [provided by RefSeq
Other Designations
OTTHUMP00000159418|methionine sulfoxide reductase|methionine-R-sulfoxide reductase|selenoprotein R
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com