Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CMPK polyclonal antibody (A01)

  • Catalog # : H00051727-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CMPK.
  • Immunogen:
  • CMPK (NP_057392, 72 a.a. ~ 181 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00051727-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CMPK polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of CMPK expression in HL-60 ( Cat # L014V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CMPK1
  • Gene Alias:
  • CMK,CMPK,UMK,UMP-CMPK,UMPK
  • Gene Description:
  • cytidine monophosphate (UMP-CMP) kinase 1, cytosolic
  • Gene Summary:
  • Uridine monophosphate (UMP)/cytidine monophosphate (CMP) kinase (EC 2.7.4.4) catalyzes the phosphoryl transfer from ATP to UMP, CMP, and deoxy-CMP (dCMP), resulting in the formation of ADP and the corresponding nucleoside diphosphate. These nucleoside diphosphates are required for cellular nucleic acid synthesis (Liou et al., 2002 [PubMed 11912132]).[supplied by OMIM
  • Other Designations:
  • Cytidine monophosphate kinase,OTTHUMP00000009565,UMP-CMP kinase,cytidylate kinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook