RAB23 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RAB23 protein.
Immunogen
RAB23 (NP_057361.3, 1 a.a. ~ 237 a.a) full-length human protein.
Sequence
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RAB23 MaxPab rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in human colon.Western Blot (Tissue lysate)
RAB23 MaxPab rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in mouse spleen.Western Blot (Cell lysate)
RAB23 MaxPab rabbit polyclonal antibody. Western Blot analysis of RAB23 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of RAB23 expression in transfected 293T cell line (H00051715-T02) by RAB23 MaxPab polyclonal antibody.
Lane 1: RAB23 transfected lysate(26.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — RAB23
Entrez GeneID
51715GeneBank Accession#
NM_016277Protein Accession#
NP_057361.3Gene Name
RAB23
Gene Alias
DKFZp781H0695, HSPC137, MGC8900
Gene Description
RAB23, member RAS oncogene family
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000016667|OTTHUMP00000040021|RAB family small GTP binding protein RAB 23|Ras-related protein Rab-23
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com