Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZNF44 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00051710-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ZNF44 protein.
  • Immunogen:
  • ZNF44 (AAH32246.1, 1 a.a. ~ 154 a.a) full-length human protein.
  • Sequence:
  • MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQHQNLRRNPRLSETWLQNFILIHYGHLVALSDGGLLQFSTGQGLPVTQAGVQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ZNF44 expression in transfected 293T cell line (H00051710-T01) by ZNF44 MaxPab polyclonal antibody.

    Lane 1: ZNF44 transfected lysate(16.94 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ZNF44
  • Gene Alias:
  • DKFZp434F1811,DKFZp686L21136,GIOT-2,KOX7,ZNF,ZNF504,ZNF55,ZNF58
  • Gene Description:
  • zinc finger protein 44
  • Other Designations:
  • gonadotropin inducible transcription repressor-2,zinc finger protein 55,zinc finger protein 58
  • RSS
  • YouTube
  • Linkedin
  • Facebook