Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYB5R1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00051706-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CYB5R1 protein.
  • Immunogen:
  • CYB5R1 (NP_057327.2, 1 a.a. ~ 305 a.a) full-length human protein.
  • Sequence:
  • MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • CYB5R1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CYB5R1 expression in human placenta.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CYB5R1 MaxPab rabbit polyclonal antibody. Western Blot analysis of CYB5R1 expression in K-562.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CYB5R1 expression in transfected 293T cell line (H00051706-T01) by CYB5R1 MaxPab polyclonal antibody.

    Lane 1: CYB5R1 transfected lysate(34.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • CYB5R1
  • Gene Alias:
  • B5R.1,NQO3A2,humb5R2
  • Gene Description:
  • cytochrome b5 reductase 1
  • Other Designations:
  • 1500005G05Rik,NAD(P)H:quinone oxidoreductase type 3, polypeptide A2,OTTHUMP00000038802
  • RSS
  • YouTube
  • Linkedin
  • Facebook