NLK monoclonal antibody (M02), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
NLK monoclonal antibody (M02), clone 2B11. Western Blot analysis of NLK expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of NLK expression in transfected 293T cell line by NLK monoclonal antibody (M02), clone 2B11.
Lane 1: NLK transfected lysate (Predicted MW: 57.1 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and NLK. HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-NLK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NLK.
Immunogen
NLK (AAH64663, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NLK monoclonal antibody (M02), clone 2B11. Western Blot analysis of NLK expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of NLK expression in transfected 293T cell line by NLK monoclonal antibody (M02), clone 2B11.
Lane 1: NLK transfected lysate (Predicted MW: 57.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and NLK. HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-NLK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — NLK
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com