VPS29 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant VPS29.
Immunogen
VPS29 (NP_476528, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Sequence
MAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — VPS29
Entrez GeneID
51699GeneBank Accession#
NM_057180Protein Accession#
NP_476528Gene Name
VPS29
Gene Alias
DC15, DC7, DKFZp564F0223, FLJ20492, PEP11
Gene Description
vacuolar protein sorting 29 homolog (S. cerevisiae)
Omim ID
606932Gene Ontology
HyperlinkGene Summary
This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. This VPS protein may be involved in the formation of the inner shell of the retromer coat for retrograde vesicles leaving the prevacuolar compartment. Alternative splice variants encoding different isoforms, and usage of multiple polyadenylation sites have been found for this gene. [provided by RefSeq
Other Designations
retromer protein|vacuolar protein sorting 29|vacuolar sorting protein VPS29/PEP11|x 007 protein
-
Interactome
-
Publication Reference
-
VPS35 dysfunction impairs lysosomal degradation of α-synuclein and exacerbates neurotoxicity in a Drosophila model of Parkinson's disease.
Miura E, Hasegawa T, Konno M, Suzuki M, Sugeno N, Fujikake N, Geisler S, Tabuchi M, Oshima R, Kikuchi A, Baba T, Wada K, Nagai Y, Takeda A, Aoki M.
Neurobiology of Disease 2014 Nov; 71:1.
Application：WB-Tr, Human, HEK293 cells.
-
VPS35 dysfunction impairs lysosomal degradation of α-synuclein and exacerbates neurotoxicity in a Drosophila model of Parkinson's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com