HECA polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HECA polyclonal antibody (A01), Lot # URB7060404QCS1. Western Blot analysis of HECA expression in NIH/3T3.
Western Blot (Cell lysate)
HECA polyclonal antibody (A01), Lot # URB7060404QCS1 Western Blot analysis of HECA expression in HepG2 ( Cat # L019V1 ).
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HECA.
Immunogen
HECA (NP_057301, 434 a.a. ~ 543 a.a) partial recombinant protein with GST tag.
Sequence
CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HECA polyclonal antibody (A01), Lot # URB7060404QCS1. Western Blot analysis of HECA expression in NIH/3T3.Western Blot (Cell lysate)
HECA polyclonal antibody (A01), Lot # URB7060404QCS1 Western Blot analysis of HECA expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — HECA
Entrez GeneID
51696GeneBank Accession#
NM_016217Protein Accession#
NP_057301Gene Name
HECA
Gene Alias
HDC, HDCL, HHDC, dJ225E12.1
Gene Description
headcase homolog (Drosophila)
Omim ID
607977Gene Ontology
HyperlinkGene Summary
This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits terminal branching of neighboring cells during tracheal development. [provided by RefSeq
Other Designations
OTTHUMP00000017312|OTTHUMP00000040226|headcase
-
Interactome
-
Disease
-
Publication Reference
-
The human HECA interacts with cyclins and CDKs to antagonize Wnt-mediated proliferation and chemoresistance of head and neck cancer cells.
Dowejko A, Bauer R, Bauer K, Muller-Richter UD, Reichert TE.
Experimental Cell Research 2012 Mar; 318(5):489.
Application：IF, Human, PCI13 cells.
-
The human homolog of the Drosophila headcase protein slows down cell division of head and neck cancer cells.
Dowejko A, Bauer RJ, Muller-Richter UD, Reichert TE.
Carcinogenesis 2009 Oct; 30(10):1678.
Application：ICC, IHC-P, Human, Human oral keratinocytes, Human oral tissues, PCI 13 cells.
-
The human HECA interacts with cyclins and CDKs to antagonize Wnt-mediated proliferation and chemoresistance of head and neck cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com