Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TPPP3 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00051673-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TPPP3 protein.
  • Immunogen:
  • TPPP3 (NP_057048.2, 1 a.a. ~ 176 a.a) full-length human protein.
  • Sequence:
  • MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TPPP3 expression in transfected 293T cell line (H00051673-T02) by TPPP3 MaxPab polyclonal antibody.

    Lane 1: TPPP3 transfected lysate(19.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • TPPP3
  • Gene Alias:
  • CGI-38,p20,p25gamma
  • Gene Description:
  • tubulin polymerization-promoting protein family member 3
  • Other Designations:
  • brain specific protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook