FKBP7 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FKBP7 MaxPab polyclonal antibody. Western Blot analysis of FKBP7 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of FKBP7 expression in transfected 293T cell line (H00051661-T01) by FKBP7 MaxPab polyclonal antibody.
Lane 1: FKBP7 transfected lysate(24.42 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FKBP7 protein.
Immunogen
FKBP7 (NP_851939.1, 1 a.a. ~ 222 a.a) full-length human protein.
Sequence
MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FKBP7 MaxPab polyclonal antibody. Western Blot analysis of FKBP7 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of FKBP7 expression in transfected 293T cell line (H00051661-T01) by FKBP7 MaxPab polyclonal antibody.
Lane 1: FKBP7 transfected lysate(24.42 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FKBP7
Entrez GeneID
51661GeneBank Accession#
NM_181342.1Protein Accession#
NP_851939.1Gene Name
FKBP7
Gene Alias
FKBP23, MGC9420, PPIase
Gene Description
FK506 binding protein 7
Omim ID
607062Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. [provided by RefSeq
Other Designations
FK506-binding protein 23|FK506-binding protein 7|peptidyl-prolyl cis-trans isomerase|rotamase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com