Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SF3B14 (Human) Recombinant Protein (P01)

  • Catalog # : H00051639-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SF3B14 full-length ORF ( AAH15463, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.49
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051639-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SF3B14
  • Gene Alias:
  • CGI-110,HSPC175,Ht006,P14,SAP14,SF3B14a
  • Gene Description:
  • splicing factor 3B, 14 kDa subunit
  • Gene Summary:
  • This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site. [provided by RefSeq
  • Other Designations:
  • pre-mRNA branch site protein p14,spliceosome-associated protein, 14 kDa subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook