Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIGT (Human) Recombinant Protein (Q01)

  • Catalog # : H00051604-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PIGT partial ORF ( NP_057021.2, 24 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTVTDV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051604-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • PIGT
  • Gene Alias:
  • CGI-06,FLJ41596,MGC8909,NDAP
  • Gene Description:
  • phosphatidylinositol glycan anchor biosynthesis, class T
  • Gene Summary:
  • This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq
  • Other Designations:
  • GPI transamidase component PIG-T,GPI transamidase subunit,neurotrophin-regulated neuronal development-associated protein,phosphatidyl inositol glycan class T,phosphatidylinositol glycan, class T
  • RSS
  • YouTube
  • Linkedin
  • Facebook