TRIM33 monoclonal antibody (M01), clone 6D1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM33.
Immunogen
TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (95); Rat (82)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TRIM33 monoclonal antibody (M01), clone 6D1. Western Blot analysis of TRIM33 expression in HeLa.Western Blot (Cell lysate)
TRIM33 monoclonal antibody (M01), clone 6D1. Western Blot analysis of TRIM33 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
TRIM33 monoclonal antibody (M01), clone 6D1. Western Blot analysis of TRIM33 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIM33 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — TRIM33
Entrez GeneID
51592GeneBank Accession#
NM_015906Protein Accession#
NP_056990Gene Name
TRIM33
Gene Alias
FLJ32925, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA
Gene Description
tripartite motif-containing 33
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000013662|OTTHUMP00000013663|ret-fused gene 7|transcriptional intermediary factor 1 gamma|tripartite motif-containing 33 protein
-
Interactome
-
Publication Reference
-
Tumour TIF1 mutations and loss of heterozygosity related to cancer-associated myositis.
Pinal-Fernandez I, Ferrer-Fabregas B, Trallero-Araguas E, Balada E, Martínez MA, Milisenda JC, Aparicio-Español G, Labrador-Horrillo M, Garcia-Patos V, Grau-Junyent JM, Selva-O'Callaghan A.
Rheumatology (Oxford, England) 2018 Feb; 57(2):388.
Application:IHC-Fr, Human, Human myositis skin biopsies.
-
Reduced expression of TIF1γ promotes metastasis and indicates poor prognosis of hepatocellular carcinoma.
Ding ZY, Jin GN, Wang W, Chen WX, Wu YH, Ai X, Chen L, Zhang WG, Liang HF, Laurence A, Zhang MZ, Datta PK, Zhang B, Chen XP.
Hepatology 2014 Nov; 60(5):1620.
Application:IF, IHC-P, WB-Ce, Human, Mouse, Hepatocellular carcinoma, AML12, QSG7701, HL7702, HepG2, Hep3B, Huh7, HLE, SMMC7721, Bel7402, MHCC97L, MHCC97H, HCCLM3 cells.
-
Tumour TIF1 mutations and loss of heterozygosity related to cancer-associated myositis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com