Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PCQAP (Human) Recombinant Protein (Q01)

  • Catalog # : H00051586-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PCQAP partial ORF ( NP_056973, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051586-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • MED15
  • Gene Alias:
  • ARC105,CAG7A,CTG7A,DKFZp686A2214,DKFZp762B1216,FLJ42282,FLJ42935,PCQAP,TIG-1,TIG1,TNRC7
  • Gene Description:
  • mediator complex subunit 15
  • Gene Summary:
  • The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • CTG repeat protein 7a,PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein,PC2-glutamine-rich-associated protein,TPA inducible gene-1,TPA inducible protein,activator-recruited cofactor, 105-kD,positive cofactor 2, glutamine/
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook