Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARMCX3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00051566-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ARMCX3 partial ORF ( NP_057691, 278 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.96
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00051566-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • ARMCX3
  • Gene Alias:
  • ALEX3,DKFZp781N1954,KIAA0443,MGC12199,dJ545K15.2
  • Gene Description:
  • armadillo repeat containing, X-linked 3
  • Gene Summary:
  • This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • 1200004E24Rik,OTTHUMP00000023688,arm protein lost in epithelial cancers, X chromosome, 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook